PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462950806
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 599aa    MW: 67120.9 Da    PI: 5.7031
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462950806genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.41.6e-10372421756
                --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                + +  +e+L ++F++n  p ++ +e+L+++l+++ +++  WF+N R kek
  462950806 372 IPPAAVEVLRKVFAENELPPRNVKEDLSRELDISFEKIDKWFKNTRLKEK 421
                567789******************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-11351421IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-10358417IPR009057Homeodomain-like
PROSITE profilePS5007113.459363423IPR001356Homeobox domain
SMARTSM003896.3E-9365427IPR001356Homeobox domain
CDDcd000861.02E-8366421No hitNo description
PfamPF000463.3E-8371421IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MDSSENKLVC SNSGRSSQRR KQTAAKSSTV SKKPSRRNAP RKCKPDSRLK RSPRKVRNAT  60
LAKCIRNKYH CSPQKQQRGS DSVAGKNVTG LTARRKRKRQ NTDEMTRLER RARYFLIKIK  120
CEQNLLDAYS GDGWNGQSRE KIKPQKELQR AKKQIIKYKI AIRDVIHQLD LSNSSGSISD  180
LAMPADGSVV EHDIFKEATE TIDSEGGLDE DWLSEYSGDE DYDPEENEVS STTSRSVDSG  240
EGVMSDGSSG SGSPLYSPND DIPDFISADF NDAEGLCNTY LDLSVDCGDD DVPQILTYQR  300
PRRDVDYRRL NDEMFGKLVE NEEQSEDEDW GGCKRKKRRV NSAVVGVNSV EGFSNDIPDG  360
KVQKQRRKLF RIPPAAVEVL RKVFAENELP PRNVKEDLSR ELDISFEKID KWFKNTRLKE  420
KVTIQHRAKD HEQVKEKLES QARLKKTVIL VPAIAQEQMK ELERPSPGNN SCLGEDSSHP  480
INTDTCAEEQ DASGMDTGAL TCLQGTTSPK SQSCLLTDLS HPTNNEVSCE EQVASCMDAG  540
ISDYQPFLDV IDEMCVLENR LQILRENMLS SGSVVANDVS DLQNQTVVLV PAAELKEKA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19398RRKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451539.11e-137hypothetical protein SORBIDRAFT_04g003450
TrEMBLM8BZL01e-162M8BZL0_AEGTA; Uncharacterized protein
STRINGSb04g003450.11e-137(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85502227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.13e-22pathogenesis related homeodomain protein A